PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009626107.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 408aa    MW: 46228.4 Da    PI: 7.2757
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009626107.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.57.6e-51431682128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                     +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+ + s++
  XP_009626107.1  43 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSEN 136
                     79***************************.89***************8778899***************************************** PP

             NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ +glkktLvfy+g+apkg +t+W+m+eyrl
  XP_009626107.1 137 SQSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 168
                     ******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.71442189IPR003441NAC domain
SuperFamilySSF1019416.02E-5642188IPR003441NAC domain
PfamPF023652.8E-2544168IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MAIVPFTSII MSQSQQHEQQ DDTINNINNT IKDDDDHEHD MVMPGFRFHP TEEELVEFYL  60
RRKVEGKRFN VELITFLDLY RYDPWELPAL AAIGEKEWYF YVPRDRKYRN GDRPNRVTTS  120
GYWKATGADR MIRSENSQSI GLKKTLVFYS GKAPKGIRTS WIMNEYRLPQ HETERLQKAE  180
ISLCRVHKRS GVEDHPSLPR SLPTTRASSS SSSRGTTNSI KKQHHQQVVQ NSLISPYVVG  240
QSSQQQIDEK LSTETSASST STDHHHHHHV ATSLGLNSLS NSYNSIALDP MAGGAVTSTS  300
SLSPFASLVS PSSTGAVVED LHKLINLDQQ VAFHNQQHFH NNPINHIPAV ASQQFLQPQV  360
LPHHAQPQSL LFQGSLQSSS SFSDRLWEWS SIQTDANCKD YQPNNPFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-56311896165NO APICAL MERISTEM PROTEIN
1ut4_B5e-56311896165NO APICAL MERISTEM PROTEIN
1ut7_A5e-56311896165NO APICAL MERISTEM PROTEIN
1ut7_B5e-56311896165NO APICAL MERISTEM PROTEIN
4dul_A5e-56311896165NAC domain-containing protein 19
4dul_B5e-56311896165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626107.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like isoform X1
TrEMBLK4B1K21e-174K4B1K2_SOLLC; Uncharacterized protein
STRINGSolyc01g102740.2.11e-174(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38882446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-110NAC domain containing protein 35